compare

Comparison List

mRFP1.3

mRFP1.3 is a fluorescent protein published in 2004, derived from Discosoma sp.. It is reported to be a monomer.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.7 kDa -

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

no photostability measurements available ... add one!

mRFP1.3 Sequence

mRFP1.3 was derived from mRFP1.1 with the following mutations: M1_D6delinsMVSKGEENNMA/A225G/*224MextDELYK
amino acid numbers relative to DsRed. show relative to mRFP1.1

MVSKGEENNMAVIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKMRLKLKDGGHYDAEVKTTYMAKKPVQLPGAYKTDIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Excerpts

Because Aequorea victoria green fluorescent protein (GFP) is relatively indifferent to N- or C-terminal fusions, we eventually generated mRFP1.3 by replacing the first seven amino acids of mRFP1.1 with the corresponding residues from enhanced GFP (MVSKGEE) followed by a spacer sequence NNMA (numbered 6a–d), and appending the last seven amino acids of GFP to the C terminus. mRFP1.3, unlike its predecessors, was found to have an equivalent high level of fluorescence regardless of fusions to its N terminus.

Shaner et al. (2004)

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change