compare

Comparison List

mRed7Q1S1

mRed7Q1S1 is a basic (constitutively fluorescent) red fluorescent protein published in 2016, derived from synthetic construct.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer synthetic construct 26.3 kDa -

FPbase ID: 9TBLQ

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
569 595          

Photostability

No photostability measurements available ... add one!

mRed7Q1S1 Sequence

mRed7Q1S1 was derived from mRed7Q1 with the following mutations: V74T/Q164M

MVSKGEEVIKEFMQFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSRAYTKHPADIPDYFKLSFPEGFKWERVMNFEDGGAVTVTQDSSLEDGTLIYKVKFRGTNFPPDGPVMQKKTMGWEPSTERLYPQDGVLKGEISMALKLKDGGHYLVDFKTTYMAKKPVQLPGAYNVDRKLDITSHNEDYTVVEQYERAEGRHSTGGMDELYK

Excerpts

No excerpts have been added for mRed7Q1S1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change