compare

Comparison List

mPlum-E16P

mPlum-E16P is a basic (constitutively fluorescent) red fluorescent protein published in 2012, derived from Discosoma sp.. It has low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer Discosoma sp. 25.6 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
590 630 0.14   4.7    

Photostability

no photostability measurements available ... add one!

mPlum-E16P Sequence

mPlum-E16P was derived from mPlum with the following mutations: E16P
amino acid numbers relative to DsRed. show relative to mPlum

MVSKGEEVIKEFMRFKPHMEGSVNGHEFEIEGEGEGRPYEGTQTARLKVTKGGPLPFAWDILSPQIMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKVRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEMKMRLRLKDGGHYDAEVKTTYMAKKPVQLPGAYKTDIKLDITSHNEDYTIVEQYERAEGRHSTGA

Structure

Deposited: ,
Chromophore:

Excerpts

... some RFPs express as mixtures of proteins with either green or red chromophores. DsRed and its mutant mPlum are notable examples of RFPs that express in this fashion. Fast and complete maturation to the red chromophore is a desired property for RFPs used in imaging experiments. Here, we present a rational approach to enhance RFP chromophore maturation in the DsRed mutant mPlum. Because residues at position 16 interact directly with the peptide bond that oxidizes during red chromophore formation, we postulated that this interaction could interfere with the oxidation reaction at this position. Using rational design, we converted a yellow-emitting mPlum mutant to a red-emitting RFP by replacing Glu16 with small non-polar amino acids. We also created an optimized mPlum mutant (mPlum-E16P) that matures almost exclusively to the red chromophore.

Moore et al. (2012)

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change