compare

Comparison List

mPapaya0.7

mPapaya0.7 is a basic (constitutively fluorescent) yellow fluorescent protein published in 2013, derived from Zoanthus sp.. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Zoanthus sp. 27.0 kDa -

FPbase ID: LGDN9

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
529 541 23,000 0.69 15.87 6.8    

Photostability

No photostability measurements available ... add one!

mPapaya0.7 Sequence

mPapaya0.7 was derived from mPapaya0.6 with the following mutations: F97Y
amino acid numbers relative to zFP538. show relative to mPapaya0.6

Note: Fig 2 and Fig S1 and Table S2 of Hoi (2013) erroneously show mPapaya0.7 (and therefore mPapaya1) with F99Y. The correct mutation is F97Y , as shown in the GenBank AGX93076 sequence (and Addgene mPapaya1 plasmids).

MVSKGEGQSKHGLKEEMTVKYHMEGCVNGHKFVITGEGIGNPFKGKQTANLCVIEGGPLPFSEDILSPGFKYGDRIFTEYPQDIVDYFKNSCPAGYTWERSYLFEDGAVCRCNVDITVSEKENCIYHKSIFRGVNFPADGPVMKKMTTNWEASTEKIVPVPKQGILKGKVKMYLLLKDGGRYHCQFDTVYKAKSVPSKMPEWHFIQHKLLREDRSDAKNQKWQLTEHAIAGMDELYK

Excerpts

No excerpts have been added for mPapaya0.7
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

An Engineered Monomeric Zoanthus sp. Yellow Fluorescent Protein

Hoi H, Howe Es, Ding Y, Zhang W, Baird Ma, Sell Br, Allen Jr, Davidson Mw, Campbell Re

(2013). Chemistry & Biology, 20(10) , 1296-1304. doi: 10.1016/j.chembiol.2013.08.008. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change