compare

Comparison List

mPapaya0.6

mPapaya0.6 is a fluorescent protein published in 2013, derived from Zoanthus sp.. It is reported to be a monomer.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
Monomer Zoanthus sp. 27.0 kDa -

FPbase ID: NYTRE

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

mPapaya0.6 OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
95.1 ± 1.1 (10000 cells) - HeLa Hoi et al. (2013)

Photostability

No photostability measurements available ... add one!

mPapaya0.6 Sequence

mPapaya0.6 was derived from mPapaya0.3 with the following mutations: H3Q/Y127R/C149T/S166K
amino acid numbers relative to zFP538. show relative to mPapaya0.3

MVSKGEGQSKHGLKEEMTVKYHMEGCVNGHKFVITGEGIGNPFKGKQTANLCVIEGGPLPFSEDILSPGFKYGDRIFTEYPQDIVDYFKNSCPAGYTWERSFLFEDGAVCRCNVDITVSEKENCIYHKSIFRGVNFPADGPVMKKMTTNWEASTEKIVPVPKQGILKGKVKMYLLLKDGGRYHCQFDTVYKAKSVPSKMPEWHFIQHKLLREDRSDAKNQKWQLTEHAIAGMDELYK

Excerpts

A drawback of mPapaya0.6 that soon became apparent was relatively poor photostability under typical live cell imaging conditions. Similar to mTFP0.7, photobleached mPapaya0.6 displayed a 410 nm absorbance peak attributable to the protonated state of the chromophore and was observed to recover fluorescence when stored in the dark

Hoi et al. (2013)

Primary Reference

An Engineered Monomeric Zoanthus sp. Yellow Fluorescent Protein

Hoi H, Howe Es, Ding Y, Zhang W, Baird Ma, Sell Br, Allen Jr, Davidson Mw, Campbell Re

(2013). Chemistry & Biology, 20(10) , 1296-1304. doi: 10.1016/j.chembiol.2013.08.008. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change