compare

Comparison List

moxMaple3

moxMaple3 is a photoconvertible green fluorescent protein published in 2018, derived from Clavularia sp..
+
moxMaple3 Spectrum Fluorescent protein moxMaple3 excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Clavularia sp. 27.2 kDa -

FPbase ID: LY1S9

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green 490 506 14,800 0.37 5.48      
Red 569 584 24,230 0.52 12.6      

Transitions

From To Switch λ
Green Red 405

Photostability

No photostability measurements available ... add one!

moxMaple3 Sequence

moxMaple3 was derived from mMaple3 with the following mutations: C143V/N144Q/C213A/N259D
amino acid numbers relative to cFP484. show relative to mMaple3

MVSKGEETIMSVIKPDMKIKLRMEGNVNGHAFVIEGEGSGKPFEGIQTIDLEVKEGAPLPFAYDILTTAFHYGNRVFTKYPRKIPDYFKQSFPEGYSWERSMTYEDGGIVQATNDITMEEDSFINKIHFKGTNFPPNGPVMQKRTVGWEVSTEKMYVRDGVLKGDVKMKLLLKGGSHYRADFRTTYKVKQKAVKLPKAHFVDHRIEILSHDKDYNKVKLYEHAVARDSTDSMDELYK

Excerpts

No excerpts have been added for moxMaple3
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change