compare

Comparison List

moxDendra2

moxDendra2 is a photoconvertible orange fluorescent protein published in 2017, derived from Dendronephthya sp..
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Dendronephthya sp. 26.1 kDa -

FPbase ID: Y46HX

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Red 551 571 31,200 0.55 17.16      
Green 490 504 50,300 0.5 25.15      

Transitions

From To Switch λ
Green Red 405

Photostability

State t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
Red 330.0 4.4 (mW/cm2) Arc-lamp Widefield Kaberniuk et al. (2017)
Green 10.0 4.4 (mW/cm2) Arc-lamp Widefield Kaberniuk et al. (2017)

moxDendra2 Sequence

moxDendra2 was derived from Dendra2 with the following mutations: N41Q/C101A/C113T/C171A/N200Q
amino acid numbers relative to dendFP. show relative to Dendra2

MNTPGINLIKEDMRVKVHMEGNVNGHAFVIEGEGKGKPYEGTQTAQLTVKEGAPLPFSYDILTTAVHYGNRVFTKYPEDIPDYFKQSFPEGYSWERTMTFEDKGIATIRSDISLEGDTFFQNVRFKGTNFPPNGPVMQKKTLKWEPSTEKLHVRDGLLVGNINMALLLEGGGHYLADFKTTYKAKKVVQLPDAHFVDHRIEILGQDSDYNKVKLYEHAVARYSPLPSQVW

Excerpts

No excerpts have been added for moxDendra2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

moxDendra2: an inert photoswitchable protein for oxidizing environments

Kaberniuk Aa, Morano Nc, Verkhusha Vv, Snapp El

(2017). Chemical Communications, 53(13) , 2106-2109. doi: 10.1039/c6cc09997a. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change