compare

Comparison List

mKO2

a.k.a. mKusabira-Orange2

mKO2 is a basic (constitutively fluorescent) orange fluorescent protein published in 2008, derived from Verrillofungia concinna. It has moderate acid sensitivity.
+
mKO2 Spectrum Fluorescent protein mKO2 excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Verrillofungia concinna 24.5 kDa -

FPbase ID: 134NN

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
551 565 63,800 0.62 39.56 5.5 108.0  

mKO2 OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
68.4 ± 4.2 (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
5.0   Sakaue-Sawano et al. (2008)

mKO2 Sequence

mKO2 was derived from mKO with the following mutations: K48E/P69V/F175M/K184E/K187E/S191D/S195G/L209Q
amino acid numbers relative to KO. show relative to mKO

MVSVIKPEMKMRYYMDGSVNGHEFTIEGEGTGRPYEGHQEMTLRVTMAEGGPMPFAFDLVSHVFCYGHRVFTKYPEEIPDYFKQAFPEGLSWERSLEFEDGGSASVSAHISLRGNTFYHKSKFTGVNFPADGPIMQNQSVDWEPSTEKITASDGVLKGDVTMYLKLEGGGNHKCQMKTTYKAAKEILEMPGDHYIGHRLVRKTEGNITEQVEDAVAHS
GenBank: BAG06989
IPG: 14335281

Excerpts

No excerpts have been added for mKO2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Two-Photon Excitation Spectra of Various Fluorescent Proteins within a Broad Excitation Range

    Leben R, Lindquist Rl, Hauser Ae, Niesner R, Rakhymzhan A

    (2022). International Journal of Molecular Sciences, 23(21) , 13407. doi: 10.3390/ijms232113407. Article

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change