compare

Comparison List

KikGR1

a.k.a. Kikume Green-Red

KikGR1 is a photoconvertible green/yellow fluorescent protein published in 2005, derived from Favia favus. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Tetramer Favia favus 25.9 kDa -

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green 507 517 53,700 0.7 37.59 7.8    
Red 583 593 35,100 0.65 22.82 5.5    

Transitions

From To Switch λ
Green Red 365

Photostability

no photostability measurements available ... add one!

KikGR1 Sequence

MVSVITSEMKIELRMEGAVNGHKFVITGKGSGQPFEGIQNVDLTVIEGGPLPFAFDILTTAFHYGNRVFVEYPEEIVDYFKQSFPEGYSWERSMSYEDGGICLATNNITMKKDGSNCFVNEIRFDGVNFPANGPVMQRKTVKWEPSTEKMYVRDGVLKGDVNMALLLQGGGHYRCDFRTTYKAKKVVQLPDYHFVDHQMEITSHDKDYNKVKLYEHAKAHSGLPRLAK

Excerpts

No excerpts have been added for KikGR1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change