compare

Comparison List

mKikGR

a.k.a. monomeric Kikume Green-Red, mKikGR1

mKikGR is a photoconvertible green/yellow fluorescent protein published in 2008, derived from Favia favus. It has high acid sensitivity.
+
mKikGR Spectrum Fluorescent protein mKikGR excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Favia favus 26.5 kDa -

FPbase ID: RHTPG

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Red 580 591 28,000 0.63 17.64 5.2    
Green 505 515 49,000 0.69 33.81 6.6    

Transitions

From To Switch λ
Green Red 390

Photostability

No photostability measurements available ... add one!

mKikGR Sequence

mKikGR was derived from KikGR1 with the following mutations: A17S/Q32R/F34Y/I37T/N39T/C116T/V126T/N161E/Q167E/F193Y/L212A/H219Y/L222T/P223Y/L225G/*226YextEFEA
amino acid numbers relative to KikG. show relative to KikGR1

MSVITSEMKIELRMEGSVNGHKFVITGKGSGRPYEGTQTVDLTVIEGGPLPFAFDILTTAFHYGNRVFVEYPEEIVDYFKQSFPEGYSWERSMSYEDGGICLATNNITMKKDGSNTFVNEIRFDGTNFPANGPVMQRKTVKWEPSTEKMYVRDGVLKGDVEMALLLEGGGHYRCDFRTTYKAKKVVQLPDYHYVDHQMEITSHDKDYNKVKAYEHAKAYSGTYRGAKYEFEA

Excerpts

No excerpts have been added for mKikGR
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

mKikGR, a Monomeric Photoswitchable Fluorescent Protein

Habuchi S, Tsutsui H, Kochaniak Ab, Miyawaki A, Van Oijen Am

(2008). PLoS ONE, 3(12) , e3944. doi: 10.1371/journal.pone.0003944. Article   Pubmed

Additional References

  1. Using Photoconvertible and Extractable Fluorescent Proteins to Study Autophagy in Plants

    Abiodun Mo, Matsuoka K

    (2017). Methods in Enzymology, 588, 515-526. doi: 10.1016/bs.mie.2016.10.040. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change