compare

Comparison List

mKate S158C

mKate S158C is a basic (constitutively fluorescent) red fluorescent protein published in 2009, derived from Entacmaea quadricolor.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.0 kDa -

FPbase ID: W34KB

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
586 630 63,000 0.33 20.79      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mKate S158C Sequence

BLAST

mKate S158C was derived from mKate with the following mutations: S158C

MSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEASTEMLYPADGGLEGRCDMALKLVGGGHLICNLKTTYRSKKPAKNLKMPGVYYVDRRLERIKEADKETYVEQHEVAVARYCDLPSKLGHK

Excerpts

No excerpts have been added for mKate S158C
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Autofluorescent Proteins with Excitation in the Optical Window for Intravital Imaging in Mammals

Lin Mz, Mckeown Mr, Ng H-L, Aguilera Ta, Shaner Nc, Campbell Re, Adams Sr, Gross La, Ma W, Alber T, Tsien Ry

(2009). Chemistry & Biology, 16(11) , 1169-1179. doi: 10.1016/j.chembiol.2009.10.009. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change