compare

Comparison List

mGrape1

mGrape1 is a basic (constitutively fluorescent) red fluorescent protein published in 2009, derived from Discosoma sp.. It is reported to be a somewhat slowly-maturing monomer with low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma sp. 25.4 kDa -

FPbase ID: AL871

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
595 625 50,000 0.03 1.5 4.5 70.0  
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mGrape1 Sequence

BLAST

mGrape1 was derived from mRFP1.1 with the following mutations: M150L/V177A/T195L/I197Y

MASSEDVIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERLYPEDGALKGEIKMRLKLKDGGHYDAEAKTTYMAKKPVQLPGAYKLDYKLDITSHNEDYTIVEQYERAEGRHSTGA

Excerpts

No excerpts have been added for mGrape1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Autofluorescent Proteins with Excitation in the Optical Window for Intravital Imaging in Mammals

Lin Mz, Mckeown Mr, Ng H-L, Aguilera Ta, Shaner Nc, Campbell Re, Adams Sr, Gross La, Ma W, Alber T, Tsien Ry

(2009). Chemistry & Biology, 16(11) , 1169-1179. doi: 10.1016/j.chembiol.2009.10.009. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change