compare

Comparison List

mEos4Fast1

a.k.a. mEos4b-A60Q-L93M

mEos4Fast1 is a photoconvertible red fluorescent protein published in 2025, derived from Lobophyllia hemprichii. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Lobophyllia hemprichii 26.0 kDa -

FPbase ID: TP5Z2

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green 505 517 93,170 0.78 72.67 5.6 64.0  
Red 570 580 58,450 0.73 42.67 6.7    
Edit States/Attributes

Transitions

From To Switch λ
Green Red 405
Edit state transitions

Photostability

No photostability measurements available ... add one!

mEos4Fast1 Sequence

BLAST

mEos4Fast1 was derived from mEos4b-L93M with the following mutations: A60Q
amino acid numbers relative to EosFP. show relative to mEos4b-L93M

MVSAIKPDMRIKLRMEGNVNGHHFVIDGDGTGKPYEGKQTMDLEVKEGGPLPFAFDILTTQFHYGNRVFVKYPDNIQDYFKQSFPKGYSWERSMTFEDGGICNARNDITMEGDTFYNKVRFYGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIEMALLLEGNAHYRCDFRTTYKAKEKGVKLPGAHFVDHAIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Excerpts

Introducing the single A60Q mutation resulted in maturation times of 209 ± 13 min for mEos4b-A60Q and 64 ± 5 min for mEos4b-A60Q-L93M. We named this fast-maturing double mutant mEos4Fast1.

Maity et al. (2025)

Primary Reference

Decoding mEos4b day‐long maturation and engineering fast‐maturing variants

Maity A, Glushonkov O, Ayala I, Tacnet P, Wulffelé J, Frachet P, Brutscher B, Bourgeois D, Adam V

(2025). Protein Science, 34(8) , e70234. doi: 10.1002/pro.70234. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change