compare

Comparison List

mEos4b-L93M

mEos4b-L93M is a photoconvertible red fluorescent protein published in 2025, derived from Lobophyllia hemprichii. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Lobophyllia hemprichii 25.9 kDa -

FPbase ID: F3GZ1

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green 504 515 77,120 0.68 52.44 6.3 81.0  
Red 569 580 57,200 0.63 36.04 6.3    
Edit state transitions

Photostability

No photostability measurements available ... add one!

mEos4b-L93M Sequence

mEos4b-L93M was derived from mEos4b with the following mutations: L93M
amino acid numbers relative to EosFP. show relative to mEos4b

MVSAIKPDMRIKLRMEGNVNGHHFVIDGDGTGKPYEGKQTMDLEVKEGGPLPFAFDILTTAFHYGNRVFVKYPDNIQDYFKQSFPKGYSWERSMTFEDGGICNARNDITMEGDTFYNKVRFYGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIEMALLLEGNAHYRCDFRTTYKAKEKGVKLPGAHFVDHAIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Structure

Deposited: ,
Chromophore:

Excerpts

Our measurements showed that, while the mutation V69A further slowed down the maturation kinetics of mEos4b, the three other single-point mutants improved it. Despite this, the V69T and I157V mutations were still unsatisfactory, with maturation time constants exceeding 400 min. In contrast, the L93M mutant showed a drastically decreased apparent maturation time of approximately 80 min, a more than 20-fold improvement relative to the mEos4b parent and better than anyother L93 substitution we have tested.

Maity et al. (2025)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change