compare

Comparison List

mEos2-NA

mEos2-NA is a fluorescent protein published in 2012, derived from Lobophyllia hemprichii. It is reported to be a monomer.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
Monomer Lobophyllia hemprichii 25.8 kDa -

FPbase ID: 8NMUD

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

mEos2-NA Sequence

BLAST

mEos2-NA was derived from mEos2 with the following mutations: I102N/Y189A

MSAIKPDMKIKLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFHYGNRVFAKYPDNIQDYFKQSFPKGYSWERSLTFEDGGICNARNDITMEGDTFYNKVRFYGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIHMALLLEGNAHYRCDFRTTYKAKEKGVKLPGAHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Excerpts

No excerpts have been added for mEos2-NA
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Rational design of true monomeric and bright photoactivatable fluorescent proteins

Zhang M, Chang H, Zhang Y, Yu J, Wu L, Ji W, Chen J, Liu B, Lu J, Liu Y, Zhang J, Xu P, Xu T

(2012). Nature Methods, 9(7) , 727-729. doi: 10.1038/nmeth.2021. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change