compare

Comparison List

mEos2-NA

mEos2-NA is a fluorescent protein published in 2012, derived from Lobophyllia hemprichii. It is reported to be a monomer.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer Lobophyllia hemprichii 25.8 kDa -

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

no photostability measurements available ... add one!

mEos2-NA Sequence

mEos2-NA was derived from mEos2 with the following mutations: I102N/Y189A

MSAIKPDMKIKLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFHYGNRVFAKYPDNIQDYFKQSFPKGYSWERSLTFEDGGICNARNDITMEGDTFYNKVRFYGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIHMALLLEGNAHYRCDFRTTYKAKEKGVKLPGAHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Excerpts

No excerpts have been added for mEos2-NA
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change