compare

Comparison List

mBlueberry1

mBlueberry1 is a basic (constitutively fluorescent) blue fluorescent protein published in 2007, derived from Discosoma.
+
Aggregation Organism Molecular Weight Cofactor
Monomer Discosoma 26.7 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
398 452 11,000 0.48 5.28      

Photostability

no photostability measurements available ... add one!

mBlueberry1 Sequence

MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFLFGSRAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMRRKTMGWEASSERMCPEDGALKGEIKLRLKLRDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Excerpts

No excerpts have been added for mBlueberry1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

External Resources

Something missing or incorrect? Submit a change Submit a change