compare

Comparison List

mBeRFP

a.k.a. monomeric Blue light-excited RFP

mBeRFP is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2013, derived from Entacmaea quadricolor. It is reported to be a somewhat slowly-maturing monomer with moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.4 kDa -

FPbase ID: 2ERUG

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
446 611 65,000 0.27 17.55 5.6 60.0 2.0

Photostability

No photostability measurements available ... add one!

mBeRFP Sequence

mBeRFP was derived from mKate with the following mutations: S2_S2delinsVSKGE/V93S/S158D/D159Y/L174A/Y210S

MVSKGEELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSKTFINHTQGIPDFFKQSFPEGFTWERSTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEASTEMLYPADGGLEGRDYMALKLVGGGHLICNAKTTYRSKKPAKNLKMPGVYYVDRRLERIKEADKETSVEQHEVAVARYCDLPSKLGHK

Excerpts

at the same laser power, the fluorescence intensity of the LSSmKate2 was not as high as that of mBeRFP

Martin & Suzanne (2022)

Primary Reference

mBeRFP, an Improved Large Stokes Shift Red Fluorescent Protein

Yang J, Wang L, Yang F, Luo H, Xu L, Lu J, Zeng S, Zhang Z

(2013). PLoS ONE, 8(6) , e64849. doi: 10.1371/journal.pone.0064849. Article   Pubmed

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change