compare

Comparison List

mBeRFP

a.k.a. monomeric Blue light-excited RFP

mBeRFP is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2013, derived from Entacmaea quadricolor. It is reported to be a somewhat slowly-maturing monomer with moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.4 kDa -

FPbase ID: 2ERUG

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
446 611 65,000 0.27 17.55 5.6 60.0 2.0
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mBeRFP Sequence

BLAST

mBeRFP was derived from mKate with the following mutations: S2_S2delinsVSKGE/V93S/S158D/D159Y/L174A/Y210S

MVSKGEELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSKTFINHTQGIPDFFKQSFPEGFTWERSTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEASTEMLYPADGGLEGRDYMALKLVGGGHLICNAKTTYRSKKPAKNLKMPGVYYVDRRLERIKEADKETSVEQHEVAVARYCDLPSKLGHK

Excerpts

at the same laser power, the fluorescence intensity of the LSS-mKate2 was not as high as that of mBeRFP

Martin & Suzanne (2022)

Primary Reference

mBeRFP, an Improved Large Stokes Shift Red Fluorescent Protein

Yang J, Wang L, Yang F, Luo H, Xu L, Lu J, Zeng S, Zhang Z

(2013). PLoS ONE, 8(6) , e64849. doi: 10.1371/journal.pone.0064849. Article   Pubmed

Additional References

  1. mBeRFP: a versatile fluorescent tool to enhance multichannel live imaging and its applications

    Martin E, Suzanne M

    (2022). Development, 149(16) , . doi: 10.1242/dev.200495. Article   Pubmed

  2. Two-Photon Excitation Spectra of Various Fluorescent Proteins within a Broad Excitation Range

    Leben R, Lindquist Rl, Hauser Ae, Niesner R, Rakhymzhan A

    (2022). International Journal of Molecular Sciences, 23(21) , 13407. doi: 10.3390/ijms232113407. Article

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change