compare

Comparison List

mBeRFP

a.k.a. monomeric Blue light-excited RFP

mBeRFP is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2013, derived from Entacmaea quadricolor. It is reported to be a somewhat slowly-maturing monomer with moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.4 kDa -

FPbase ID: 2ERUG

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
446 611 65,000 0.27 17.55 5.6 60.0 2.0
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mBeRFP Sequence

mBeRFP was derived from mKate with the following mutations: S2_S2delinsVSKGE/V93S/S158D/D159Y/L174A/Y210S

MVSKGEELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSKTFINHTQGIPDFFKQSFPEGFTWERSTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEASTEMLYPADGGLEGRDYMALKLVGGGHLICNAKTTYRSKKPAKNLKMPGVYYVDRRLERIKEADKETSVEQHEVAVARYCDLPSKLGHK

Excerpts

No excerpts have been added for mBeRFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

mBeRFP, an Improved Large Stokes Shift Red Fluorescent Protein

Yang J, Wang L, Yang F, Luo H, Xu L, Lu J, Zeng S, Zhang Z

(2013). PLoS ONE, 8(6) , e64849. doi: 10.1371/journal.pone.0064849. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change