compare

Comparison List

LSS-mKate2

LSS-mKate2 is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2010, derived from Entacmaea quadricolor. It has very low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.2 kDa -

FPbase ID: RU9EF

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
460 605 26,000 0.17 4.42 2.7 150.0 1.4

Photostability

No photostability measurements available ... add one!

LSS-mKate2 Sequence

LSS-mKate2 was derived from mKate with the following mutations: K67Y/P127T/S143G/M160D/T176S/M189V/*230LextN
amino acid numbers relative to eqFP578. show relative to mKate

MSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSYTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFTSNGPVMQKKTLGWEAGTEMLYPADGGLEGRSDDALKLVGGGHLICNLKSTYRSKKPAKNLKVPGVYYVDRRLERIKEADKETYVEQHEVAVARYCDLPSKLGHKLN

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for LSS-mKate2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Monomeric red fluorescent proteins with a large Stokes shift

Piatkevich Kd, Hulit J, Subach Om, Wu B, Abdulla A, Segall Je, Verkhusha Vv

(2010). Proceedings of the National Academy of Sciences, 107(12) , 5369-5374. doi: 10.1073/pnas.0914365107. Article   Pubmed

Additional References

  1. mBeRFP, an Improved Large Stokes Shift Red Fluorescent Protein

    Yang J, Wang L, Yang F, Luo H, Xu L, Lu J, Zeng S, Zhang Z

    (2013). PLoS ONE, 8(6) , e64849. doi: 10.1371/journal.pone.0064849. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change