compare

Comparison List

mAvicFP1

similar: AvicFP1

mAvicFP1 is a basic (constitutively fluorescent) green fluorescent protein published in 2019, derived from Aequorea victoria. It has low acid sensitivity.
+
mAvicFP1 Spectrum Fluorescent protein mAvicFP1 excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.8 kDa -

FPbase ID: SXYKQ

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
480 503 65,000 0.63 40.95 4.9    

mAvicFP1 OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
66.0 (517 cells) 2.31 ± 0.915 (517 cells) U2-OS Lambert et al. (2019)

Photostability

No photostability measurements available ... add one!

mAvicFP1 Sequence

mAvicFP1 was derived from AvicFP1 with the following mutations: F64L/A206K

MSKGAELFNGIVPILIELNGDVHGHKFSVRGEGEGDAGSGKIEIKFVCTTGTLPVPWPTLVTTLCYGVQCFTRYPEHMKQHDFYKSAMPDGYIQKRTISFQDDGHYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGNKMEYNYNSHSVYVLSDKANNGIKVNFKIRHNLKGEGIQLADHDQQNIPIGDGPVLLPDYHYLSTQTKITKDPNEKRDHMNLVEFVTACGITHGMDELYK

Excerpts

No excerpts have been added for mAvicFP1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Live-cell nanoscopy with spontaneous blinking of conventional green fluorescent proteins

    Gavrikov As, Baranov Ms, Mishin As

    (2020). Biochemical and Biophysical Research Communications, 522(4) , 852-854. doi: 10.1016/j.bbrc.2019.11.163. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change