compare

Comparison List

AvicFP1

similar: mAvicFP1

AvicFP1 is a basic (constitutively fluorescent) green fluorescent protein published in 2019, derived from Aequorea victoria. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Weak dimer Aequorea victoria 26.8 kDa -

FPbase ID: VE1RL

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
481 503 64,000 0.63 40.32 4.9    

Photostability

No photostability measurements available ... add one!

AvicFP1 Sequence

MSKGAELFNGIVPILIELNGDVHGHKFSVRGEGEGDAGSGKIEIKFVCTTGTLPVPWPTLVTTFCYGVQCFTRYPEHMKQHDFYKSAMPDGYIQKRTISFQDDGHYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGNKMEYNYNSHSVYVLSDKANNGIKVNFKIRHNLKGEGIQLADHDQQNIPIGDGPVLLPDYHYLSTQTAITKDPNEKRDHMNLVEFVTACGITHGMDELYK

Excerpts

No excerpts have been added for AvicFP1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change