compare

Comparison List

AvicFP1

AvicFP1 is a basic (constitutively fluorescent) fluorescent protein.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? <add one> 26.8 kDa -

FPbase ID: VE1RL

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

AvicFP1 Sequence

MSKGAELFNGIVPILIELNGDVHGHKFSVRGEGEGDAGSGKIEIKFVCTTGTLPVPWPTLVTTFCYGVQCFTRYPEHMKQHDFYKSAMPDGYIQKRTISFQDDGHYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGNKMEYNYNSHSVYVLSDKANNGIKVNFKIRHNLKGEGIQLADHDQQNIPIGDGPVLLPDYHYLSTQTAITKDPNEKRDHMNLVEFVTACGITHGMDELYK

Excerpts

No excerpts have been added for AvicFP1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change