compare

Comparison List

lanRFP-ΔS83l

lanRFP-ΔS83l is a basic (constitutively fluorescent) yellow fluorescent protein published in 2013, derived from Branchiostoma lanceolatum. It has low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Branchiostoma lanceolatum 24.7 kDa -

FPbase ID: GNV89

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
521 592 71,000 0.1 7.1 4.7 720.0  
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

lanRFP-ΔS83l Sequence

BLAST
MPLPATHDLHISGSINGHEFDLEGSGKGNAKEGYQELHLKSNKGDLSFSPWILVPNIGYGFYQYLPFPDGAMSPYQAAMHDGGYVMHRSMQFEDGAMLHSDHRYIYKGNHIKGEFRLTGSGFPADGPVMTNSLTAADWCVDKLLYPNDNTIIGKFDWTYTTTSGKRYQSDVQTNVTFGKPIAADILKKQPMFVFRKVELKHTKTELNFKQWQKAFQDIA

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for lanRFP-ΔS83l
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Structure of the red fluorescent protein from a lancelet (Branchiostoma lanceolatum): a novel GYG chromophore covalently bound to a nearby tyrosine

Pletnev Vz, Pletneva Nv, Lukyanov Ka, Souslova Ea, Fradkov Af, Chudakov Dm, Chepurnykh T, Yampolsky Iv, Wlodawer A, Dauter Z, Pletnev S

(2013). Acta Crystallographica Section D Biological Crystallography, 69(9) , 1850-1860. doi: 10.1107/s0907444913015424. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change