compare

Comparison List

Kohinoor

Kohinoor is a photoswitchable green fluorescent protein published in 2015, derived from Echinophyllia sp. SC22. It has high acid sensitivity.
+
Kohinoor Spectrum Fluorescent protein Kohinoor excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Echinophyllia sp. SC22 25.3 kDa -

FPbase ID: L3C27

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
On 495 514 62,900 0.71 44.66 8.6    
Off              

Transitions

From To Switch λ
Off On 405
On Off 488

Photostability

No photostability measurements available ... add one!

Kohinoor Sequence

Kohinoor was derived from Padron with the following mutations: N102I/L141P/F173S/S190D/D192V/K202R/E218G

MSVIKPDMKIKLRMEGAVNGHPFAIEGVGLGKPFEGKQSMDLKVKEGGPLPFAYDILTMAFCYGNRVFAKYPENIVDYFKQSFPEGYSWERSMIYEDGGICIATNDITLDGDCYIYEIRFDGVNFPANGPVMQKRTVKWEPSTEKLYVRDGVLKSDGNYALSLEGGGHYRCDSKTTYKAKKVVQLPDYHDVVHHIEIKSHDRDYSNVNLHEHAEAHSGLPRQAK
GenBank: BAR64760

Excerpts

No excerpts have been added for Kohinoor
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change