compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

KikG

This protein has unmoderated changes. Click here to view the last moderated version of this protein from Dec 17, 2018 02:58:12. Or view the full change history

KikG is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2005, derived from Favia favus. It has low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization	Organism	Molecular Weight	Cofactor
Tetramer	Favia favus	25.9 kDa	-

FPbase ID: PRMX6

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
507	517	81,000	0.68	55.08	4.2

Edit States/Attributes

Photostability

No photostability measurements available ... add one!

KikG Sequence

BLAST

MSVITSEMKMELRMEGAVNGHKFVITGKGSGQPFEGIQNMDLTVIEGGPLPFAFDILTTVFDYGNRVFVKYPEEIVDYFKQSFPEGYSWERSMSYEDGGICLATNNITMKKDGSNCFVYEIRFDGVNFPANGPVMQRKTVKWEPSTEKMYVRDGVLKGDVNMALLLQGGGHYRCDFRTTYKAKKVVQLPDYHFVDHRIEITSHDKDYNKVKLYEHAKAHSGLPRLAK

Structure

PDB ID

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for KikG
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Semi-rational engineering of a coral fluorescent protein into an efficient highlighter

Tsutsui H, Karasawa S, Shimizu H, Nukina N, Miyawaki A

(2005). EMBO reports, 6(3) , 233-238. doi: 10.1038/sj.embor.7400361. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for KikG
Search RIKEN BRC for KikG

Change history

Something missing or incorrect? Submit a change Submit a change