compare

Comparison List

Katushka2S

Katushka2S is a basic (constitutively fluorescent) red fluorescent protein published in 2015, derived from Entacmaea quadricolor. It is reported to be a very rapidly-maturing dimer with moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Dimer Entacmaea quadricolor 26.4 kDa -

FPbase ID: 4E21X

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
588 633 67,000 0.44 29.48 5.4 14.0  
Edit States/Attributes

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
72.0 Widefield 25.0 Luker et al. (2015)
A caution on interpretation of photostability measurements
Add photostability info

Katushka2S Sequence

BLAST

Katushka2S was derived from Katushka with the following mutations: M1_S2insVGED/S158A

Note: M1_S2insVGED is not a defining mutation in Katushka2S, the parental protein Katushka is sometimes shown with M1_S2insVGED as well (e.g. at SnapGene)

MVGEDSVLITENMHMKLYMEGTVNDHHFKCTSEGEGKPYEGTQTMKIKVVEGGPLPFAFDILATSFMYGSKTFINHTQGIPDFFKQSFPEGFTWERITTYEDGGVLTATQDTSLQNGCLIYNVKINGVNFPSNGPVMQKKTLGWEASTEMLYPADSGLRGHAQMALKLVGGGYLHCSLKTTYRSKKPAKNLKMPGFYFVDRRLERIKEADKETYVEQHEMAVARYCDLPSKLGHS

Excerpts

No excerpts have been added for Katushka2S
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Comparative study reveals better far-red fluorescent protein for whole body imaging

Luker Ke, Pata P, Shemiakina Ii, Pereverzeva A, Stacer Ac, Shcherbo Ds, Pletnev Vz, Skolnaja M, Lukyanov Ka, Luker Gd, Pata I, Chudakov Dm

(2015). Scientific Reports, 5(1) , 10332. doi: 10.1038/srep10332. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change