compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

GFPmut3

You are viewing an older revision of this protein, from Dec 5, 2018 01:52:58. Click here to view the current version.

GFPmut3 is a fluorescent protein published in 1996, derived from Aequorea victoria.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization	Organism	Molecular Weight	Cofactor
?	Aequorea victoria	26.8 kDa	-

FPbase ID: A2OWC

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

GFPmut3 Sequence

BLAST

GFPmut3 was derived from avGFP with the following mutations: S65G/S72AS65G/S72A

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for GFPmut3
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

FACS-optimized mutants of the green fluorescent protein (GFP)

Cormack Bp, Valdivia Rh, Falkow S

(1996). Gene, 173(1) , 33-38. doi: 10.1016/0378-1119(95)00685-0. Article

Additional References

No additional references have been added.

External Resources

Search Addgene for GFPmut3
Search RIKEN BRC for GFPmut3

Change history

Something missing or incorrect? Submit a change Submit a change