compare

Comparison List

GFPmut3

a.k.a. GFPmut3b

similar: mGFPmut3

GFPmut3 is a basic (constitutively fluorescent) green fluorescent protein published in 1996, derived from Aequorea victoria. It is reported to be a very rapidly-maturing weak dimer.
+
Oligomerization Organism Molecular Weight Cofactor
Weak dimer Aequorea victoria 26.8 kDa -

FPbase ID: A2OWC

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
500 513 89,400 0.39 34.87   4.1  

Photostability

No photostability measurements available ... add one!

GFPmut3 Sequence

GFPmut3 was derived from avGFP with the following mutations: S65G/S72A

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GenBank: AAB18957.1

Excerpts

No excerpts have been added for GFPmut3
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

FACS-optimized mutants of the green fluorescent protein (GFP)

Cormack Bp, Valdivia Rh, Falkow S

(1996). Gene, 173(1) , 33-38. doi: 10.1016/0378-1119(95)00685-0. Article

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change