compare

Comparison List

Gamillus0.2

a.k.a. GFP with acid tolerance and monomeric properties to illuminate soured environments

Gamillus0.2 is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2018, derived from Olindias formosus. It has low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Olindias formosus 25.7 kDa -

FPbase ID: WLNHW

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
505 524 55,000 0.94 51.7 4.0    

Photostability

No photostability measurements available ... add one!

Gamillus0.2 Sequence

Gamillus0.2 was derived from Gamillus0.1 with the following mutations: P162L

MASGRALFQYPMTSKIELNGEINGKKFKVAGEGFTPNSGRFNMHAYCTTGDLPMSWVVIASPLQYGFHMFAHYPEDITHFFQECFPGSYTLDRTLRMEGDGTLTTHHEYSLKDGCVTSKTTLNASGFDPKGATMTKSFVEQLPNQVEITAEGNGIRLTSTVLYLKKDGTIQIGRQDCIVKPVGGKKVTQPKAHFLHTQIIQKKDPNDTRDHIVQTELAVAGNPWHEPSASAV

Excerpts

No excerpts have been added for Gamillus0.2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Acid-Tolerant Monomeric GFP from Olindias formosa

Shinoda H, Ma Y, Nakashima R, Sakurai K, Matsuda T, Nagai T

(2018). Cell Chemical Biology, 25(3) , 330-338.e7. doi: 10.1016/j.chembiol.2017.12.005. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change