compare

Comparison List

FusionRed-MQV

a.k.a. FR-MQV

FusionRed-MQV is a basic (constitutively fluorescent) red fluorescent protein published in 2020, derived from Entacmaea quadricolor. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 25.6 kDa -

FPbase ID: F35B7

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
566 585 144,000 0.53 76.32 4.6 195.0 2.77
Edit States/Attributes

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
38.0 5.0 (W/cm2) LED Widefield E.Coli 37.0 Mukherjee et al. (2020)
A caution on interpretation of photostability measurements
Add photostability info

FusionRed-MQV Sequence

BLAST

FusionRed-MQV was derived from FusionRed-M with the following mutations: M41Q/C158V
amino acid numbers relative to eqFP578. show relative to FusionRed-M

MVSELIKENMPMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTQRIKVVEGGPLPFAFDILATSFMYGSRTFIKHPPGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKVRGVNFPANGPVMQKKTLGWEASTETMYPADGGLEGAVDMALKLVGGGHLICNMETTYRSKKPATNLKMPGVYNVDHRLERIKEADDETYVEQHEVAVARYSTGGAGDGGK

Excerpts

No excerpts have been added for FusionRed-MQV
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Engineering of a Brighter Variant of the FusionRed Fluorescent Protein Using Lifetime Flow Cytometry and Structure-Guided Mutations

Mukherjee S, Hung S-T, Douglas N, Manna P, Thomas C, Ekrem A, Palmer Ae, Jimenez R

(2020). Biochemistry, 59(39) , 3669-3682. doi: 10.1021/acs.biochem.0c00484. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change