compare

Comparison List

frSkylan-S

frSkylan-S is a photoswitchable green fluorescent protein published in 2021, derived from Lobophyllia hemprichii.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Lobophyllia hemprichii 25.8 kDa -

FPbase ID: 8DFHZ

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
499 513 95,400 0.8 76.32     2.93
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

frSkylan-S Sequence

BLAST

frSkylan-S was derived from mEos4b with the following mutations: H62S
amino acid numbers relative to EosFP. show relative to mEos4b

MVSAIKPDMRIKLRMEGNVNGHHFVIDGDGTGKPYEGKQTMDLEVKEGGPLPFAFDILTTAFSYGNRVFVKYPDNIQDYFKQSFPKGYSWERSLTFEDGGICNARNDITMEGDTFYNKVRFYGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIEMALLLEGNAHYRCDFRTTYKAKEKGVKLPGAHFVDHAIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Excerpts

We combined the amino acid substitutions of two Eos protein derivatives, Skylan-S and mEos4b, which are a green reversibly photoswitchable fluorescent protein (RSFP) and a fixation-resistant green-to-red photoconvertible fluorescent protein, respectively, resulting in the fixation-resistant Skylan-S (frSkylan-S), a green RSFP.

Osuga et al. (2021)

Primary Reference

Development of a green reversibly photoswitchable variant of Eos fluorescent protein with fixation resistance

Osuga M, Nishimura T, Suetsugu S

(2021). Molecular Biology of the Cell, 32(21) , . doi: 10.1091/mbc.e21-01-0044. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change