compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

Folding Reporter GFP

You are viewing an older revision of this protein, from Dec 18, 2018 03:24:42. Click here to view the current version.

Folding Reporter GFP is a basic (constitutively fluorescent) green fluorescent protein published in 2005, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization	Organism	Molecular Weight	Cofactor
Dimer	Aequorea victoria	26.8 kDa	-

FPbase ID: N6ZHS

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
490	530	82,400	0.72	59.33

Edit States/Attributes

Photostability

No photostability measurements available ... add one!

Folding Reporter GFP Sequence

BLAST

Folding Reporter GFP was derived from αGFP with the following mutations: F64L/S65TF64L/S65T

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Structure

PDB ID

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for Folding Reporter GFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Engineering and characterization of a superfolder green fluorescent protein

Pédelacq J-D, Cabantous S, Tran T, Terwilliger Tc, Waldo Gs

(2005). Nature Biotechnology, 24(1) , 79-88. doi: 10.1038/nbt1172. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for Folding Reporter GFP
Search RIKEN BRC for Folding Reporter GFP

Change history

Something missing or incorrect? Submit a change Submit a change