compare

Comparison List

αGFP

a.k.a. cycle 3, alphaGFP, GFPuv

αGFP is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 1996, derived from Aequorea victoria.
+
Oligomerization Organism Molecular Weight Cofactor
Dimer Aequorea victoria 26.8 kDa -

FPbase ID: B28N7

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
397 506 30,000 0.79 23.7      

Photostability

No photostability measurements available ... add one!

αGFP Sequence

αGFP was derived from avGFP with the following mutations: Q80R/F99S/M153T/V163A

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for αGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Improved Green Fluorescent Protein by Molecular Evolution Using DNA Shuffling

Crameri A, Whitehorn Ea, Tate E, Stemmer Wpc

(1996). Nature Biotechnology, 14(3) , 315-319. doi: 10.1038/nbt0396-315. Article   Pubmed

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change