compare

Comparison List

Emerald

similar: mEmerald

Emerald is a fluorescent protein published in 1998, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
? Aequorea victoria 26.9 kDa -

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

no photostability measurements available ... add one!

Emerald Sequence

Emerald was derived from GFP (S65T) with the following mutations: M1_S2insV/F64L/S72A/N149K/M153T/I167T/H231L

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHKVYITADKQKNGIKVNFKTRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for Emerald
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change