compare

Comparison List

Emerald

similar: mEmerald

Emerald is a basic (constitutively fluorescent) green fluorescent protein published in 1998, derived from Aequorea victoria. It is reported to be a very rapidly-maturing weak dimer.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Weak dimer Aequorea victoria 26.9 kDa -

FPbase ID: GLAD6

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
487 509 57,500 0.68 39.1   11.2  
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

Emerald Sequence

BLAST

Emerald was derived from EGFP with the following mutations: S72A/N149K/M153T/I167T
amino acid numbers relative to avGFP. show relative to EGFP

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHKVYITADKQKNGIKVNFKTRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for Emerald
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Chapter 2: Understanding Structure—Function Relationships in the Aequorea victoria Green Fluorescent Protein

Cubitt Ab, Woollenweber La, Heim R

(1998). Methods in Cell Biology, , 19-30. doi: 10.1016/s0091-679x(08)61946-9. Article

Additional References

  1. Systematic characterization of maturation time of fluorescent proteins in living cells

    Balleza E, Kim Jm, Cluzel P

    (2017). Nature Methods, 15(1) , 47-51. doi: 10.1038/nmeth.4509. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change