compare

Comparison List

ECFP H148D

a.k.a. H148D

ECFP H148D is a basic (constitutively fluorescent) cyan fluorescent protein published in 2004, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 26.9 kDa -

FPbase ID: D4OFQ

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
433 475 3,200 0.68 2.18      

Photostability

No photostability measurements available ... add one!

ECFP H148D Sequence

ECFP H148D was derived from ECFP with the following mutations: H148D
amino acid numbers relative to avGFP. show relative to ECFP

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTWGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISDNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for ECFP H148D
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

An improved cyan fluorescent protein variant useful for FRET

Rizzo Ma, Springer Gh, Granada B, Piston Dw

(2004). Nature Biotechnology, 22(4) , 445-449. doi: 10.1038/nbt945. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change