compare

Comparison List

dTG

dTG is a basic (constitutively fluorescent) green fluorescent protein published in 2016, derived from Discosoma sp.. It has very low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Discosoma sp. 27.0 kDa -

FPbase ID: HQZZC

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
476 500 59,000 0.14 8.26 3.8    

Photostability

No photostability measurements available ... add one!

dTG Sequence

dTG was derived from dTomato with the following mutations: Q64L/F65L/A71M/E94V/V107A/K121E/I210R/G225bD
amino acid numbers relative to DsRed. show relative to dTomato

MVSKGEEVIKEFMRFKVRMEGSMNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPLLMYGSKMYVKHPADIPDYKKLSFPEGFKWVRVMNFEDGGLVTATQDSSLQDGTLIYEVKMRGTNFPPDGPVMQKKTMGWEASTERLYPRDGVLKGEIHQALKLKDGGHYLVEFKTIYMAKKPVQLPGYYYVDTKLDITSHNEDYTRVEQYERSEGRHHLFLYDMDELYK

Excerpts

No excerpts have been added for dTG
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change