compare

Comparison List

dTFP0.2

dTFP0.2 is a basic (constitutively fluorescent) cyan fluorescent protein published in 2006, derived from Clavularia sp..

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Dimer Clavularia sp. 27.4 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
456 486 60,000 0.68 40.8      

Photostability

no photostability measurements available ... add one!

dTFP0.2 Sequence

dTFP0.2 was derived from dTFP0.1 with the following mutations: D119N/S264P
amino acid numbers relative to cFP484. show relative to dTFP0.1

MVSKGEETTMGVIKPDMKIKLKMEGNVNGHAFVIEGEGEGKPYDGTNTVNLEVKEGAPLPFSYDILSNAFQYGNRAFTKYPDDIANYFKQSFPEGYSWERTMTFEDKGIVKVKSDISMEEDSFIYEIRLKGKNFPPNGPVMQKKTLKWEPSTEILYVRDGVLVGDISHSLLLEGGGHYRCDFKTIYKAKKVVKLPDYHFVDHRIEILNHDKDYNKVTLYENAVARYSLLPPQAGMDELYK
GenBank: ABG77396
IPG: 5860095

Excerpts

No excerpts have been added for dTFP0.2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change