compare

Comparison List

dTFP0.1

a.k.a. TFP

dTFP0.1 is a basic (constitutively fluorescent) cyan fluorescent protein published in 2006, derived from Clavularia sp..

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Clavularia sp. 27.4 kDa -

FPbase ID: 2BJM7

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
456 485 42,000 0.63 26.46      

Photostability

No photostability measurements available ... add one!

dTFP0.1 Sequence

dTFP0.1 was derived from cFP484 with the following mutations: K2_L40delinsVSKGEE/H80N/L82V/L110F/F162L/D163K/M165K/M188L/S217T/*265GextMDELYK

MVSKGEETTMGVIKPDMKIKLKMEGNVNGHAFVIEGEGEGKPYDGTNTVNLEVKEGAPLPFSYDILSNAFQYGNRAFTKYPDDIADYFKQSFPEGYSWERTMTFEDKGIVKVKSDISMEEDSFIYEIRLKGKNFPPNGPVMQKKTLKWEPSTEILYVRDGVLVGDISHSLLLEGGGHYRCDFKTIYKAKKVVKLPDYHFVDHRIEILNHDKDYNKVTLYENAVARYSLLPSQAGMDELYK

Excerpts

No excerpts have been added for dTFP0.1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change