compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

Dronpa-3

Dronpa-3 is a photoswitchable green fluorescent protein published in 2007, derived from Echinophyllia sp. SC22.

No spectrum has been submitted ... add a spectrum!

Oligomerization	Organism	Molecular Weight	Cofactor
Monomer	Echinophyllia sp. SC22	25.4 kDa	-

FPbase ID: 42Q3E

Attributes

State	Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
On	490	515	58,000	0.33	19.14
Off

Edit States/Attributes

Transitions

From	To	Switch λ
Off	On	405
On	Off	490

Edit state transitions

Photostability

No photostability measurements available ... add one!

Dronpa-3 Sequence

BLAST

Dronpa-3 was derived from Dronpa with the following mutations: V157I/M159AV157I/M159A

MSVIKPDMKIKLRMEGAVNGHPFAIEGVGLGKPFEGKQSMDLKVKEGGPLPFAYDILTTVFCYGNRVFAKYPENIVDYFKQSFPEGYSWERSMNYEDGGICNATNDITLDGDCYIYEIRFDGVNFPANGPVMQKRTVKWEPSTEKLYVRDGVLKGDINAALSLEGGGHYRCDFKTTYKAKKVVQLPDYHFVDHHIEIKSHDKDYSNVNLHEHAEAHSELPRQAK

Excerpts

No excerpts have been added for Dronpa-3
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Highlighted Generation of Fluorescence Signals Using Simultaneous Two-Color Irradiation on Dronpa Mutants

Ando R, Flors C, Mizuno H, Hofkens J, Miyawaki A

(2007). Biophysical Journal, 92(12) , L97-L99. doi: 10.1529/biophysj.107.105882. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for Dronpa-3
Search RIKEN BRC for Dronpa-3

Change history

Something missing or incorrect? Submit a change Submit a change