compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

Diogenes

This protein has unmoderated changes.

Diogenes is a basic (constitutively fluorescent) red fluorescent protein published in 2025, derived from Entacmaea quadricolor. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization	Organism	Molecular Weight	Cofactor
Monomer	Entacmaea quadricolor	26.1 kDa	-

FPbase ID: 3Z9FM

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
579	603	90,000	0.44	39.6	6.1		2.2

Edit States/Attributes

Photostability

No photostability measurements available ... add one!

Diogenes Sequence

BLAST

Diogenes was derived from mKate2 with the following mutations: K68R/R198HK67R/R197H
amino acid numbers relative to mKate2eqFP578. show relative to eqFP578 show relative to mKate2

MVSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKAVEGGPLPFAFDILATSFMYGSRTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEASTETLYPADGGLEGRADMALKLVGGGHLICNLKTTYRSKKPAKNLKMPGVYYVDHRLERIKEADKETYVEQHEVAVARYCDLPSKLGHR

Excerpts

No excerpts have been added for Diogenes
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Two Key Substitutions in the Chromophore Environment of mKate2 Produce an Enhanced FusionRed-like Red Fluorescent Protein

Ruchkin Da, Gavrikov As, Kolesov Dv, Gorokhovatsky Ay, Chepurnykh Tv, Mishin As, Maximov Eg, Pletneva Nv, Pletnev Vz, Pavlova Am, Nikitin Va, Bogdanov Am

(2025). Acta Naturae, 17(2) , 118-131. doi: 10.32607/actanaturae.27545. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for Diogenes
Search RIKEN BRC for Diogenes

Change history

Something missing or incorrect? Submit a change Submit a change