compare

Comparison List

Dendra2-T69A

Dendra2-T69A is a photoconvertible red fluorescent protein published in 2016, derived from Dendronephthya sp.. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Dendronephthya sp. 26.1 kDa -

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Orange 563 578 35,400 0.64 22.66 7.0   4.2
Green 502 518 42,500 0.56 23.8 6.0   3.0

Transitions

From To Switch λ
Green Orange 405

Photostability

no photostability measurements available ... add one!

Dendra2-T69A Sequence

Dendra2-T69A was derived from Dendra2 with the following mutations: T69A
amino acid numbers relative to dendFP. show relative to Dendra2

MNTPGINLIKEDMRVKVHMEGNVNGHAFVIEGEGKGKPYEGTQTANLTVKEGAPLPFSYDILTTAVHYGNRVFAKYPEDIPDYFKQSFPEGYSWERTMTFEDKGICTIRSDISLEGDCFFQNVRFKGTNFPPNGPVMQKKTLKWEPSTEKLHVRDGLLVGNINMALLLEGGGHYLCDFKTTYKAKKVVQLPDAHFVDHRIEILGNDSDYNKVKLYEHAVARYSPLPSQVW

Excerpts

No excerpts have been added for Dendra2-T69A
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Arginine 66 Controls Dark-State Formation in Green-to-Red Photoconvertible Fluorescent Proteins

Berardozzi R, Adam V, Martins A, Bourgeois D

(2016). Journal of the American Chemical Society, 138(2) , 558-565. doi: 10.1021/jacs.5b09923. Article   Pubmed

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change