compare

Comparison List

Crimson

Crimson is a basic (constitutively fluorescent) red fluorescent protein published in 2022, derived from Entacmaea quadricolor. It is reported to be a very rapidly-maturing protein with low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Entacmaea quadricolor 27.2 kDa -

FPbase ID: 5HD4W

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
588 617 77,000 0.42 32.34 4.2 14.0  

Photostability

No photostability measurements available ... add one!

Crimson Sequence

Crimson was derived from mNeptune2 with the following mutations: H14R/M15S/M19L/T22S/N25G/H27Q/S32H/G45N/C65M/T72A/N75K/H76Y/T77P/Q78K/I80L/F83Y/V97T/T98M/T99V/Y100F/V108A/C118E/S132A/Q138K/K139Q/K140T/A146P/G157A/L178F/R183K/A187a_L188delinsV/Y194H/F195Y

MVSKGEELIKENMRSKLYLEGSVNGHQFKCTHEGEGKPYEGTQTNRIKVVEGGPLPFAFDILATMFMYGSKAFIKYPKGLPDYFKQSFPEGFTWERTMVFEDGGVLTATQDTSLQDGELIYNVKLRGVNFPANGPVMKQTTLGWEPSTETLYPADGALEGRCDMALKLVGGGHLHCNFKTTYKSKKPVKMPGVHYVDRRLERIKEADNETYVEQHEVAVARYCDLPSKLGHKLNGMDELYK
GenBank: OP047898.1

Excerpts

No excerpts have been added for Crimson
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change