compare

Comparison List

Crimson

Crimson is a basic (constitutively fluorescent) red fluorescent protein published in 2022. It is reported to be a very rapidly-maturing weak dimer with low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Weak dimer <add one> 27.2 kDa -

FPbase ID: 5HD4W

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
588 617 77,000 0.42 32.34 4.2 14.0  
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

Crimson Sequence

BLAST

Crimson was derived from mNeptune2 with the following mutations: H14R/M15S/M19L/T22S/N25G/H27Q/S32H/G45N/C65M/T72A/N75K/H76Y/T77P/Q78K/I80L/F83Y/V97T/T98M/T99V/Y100F/V108A/C118E/S132A/Q138K/K139Q/K140T/A146P/G157A/L178F/R183K/A187a_L188delinsV/Y194H/F195Y

MVSKGEELIKENMRSKLYLEGSVNGHQFKCTHEGEGKPYEGTQTNRIKVVEGGPLPFAFDILATMFMYGSKAFIKYPKGLPDYFKQSFPEGFTWERTMVFEDGGVLTATQDTSLQDGELIYNVKLRGVNFPANGPVMKQTTLGWEPSTETLYPADGALEGRCDMALKLVGGGHLHCNFKTTYKSKKPVKMPGVHYVDRRLERIKEADNETYVEQHEVAVARYCDLPSKLGHKLNGMDELYK
GenBank: OP047898.1

Excerpts

No excerpts have been added for Crimson
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

A Bright, Nontoxic, and Non-aggregating red Fluorescent Protein for Long-Term Labeling of Fine Structures in Neurons

Ning L, Geng Y, Lovett-Barron M, Niu X, Deng M, Wang L, Ataie N, Sens A, Ng H-L, Chen S, Deisseroth K, Lin Mz, Chu J

(2022). Frontiers in Cell and Developmental Biology, 10, 893468. doi: 10.3389/fcell.2022.893468. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change