compare

Comparison List

Citrine2

Citrine2 is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2018, derived from Aequorea victoria. It has moderate acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Dimer Aequorea victoria 26.9 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
509 522 98,000 0.7 68.6 5.9   3.3

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
5.34 50.0 (mW) Laser Point Scanning Confocal
59.63 Arc-lamp Widefield

Citrine2 Sequence

Citrine2 was derived from mCitrine with the following mutations: S30T/M69T/Y145H/N149Y/V163A/K206Q/K214E/M218T/D234G
amino acid numbers relative to avGFP. show relative to mCitrine

MVSKGEELFTGVVPILVELDGDVNGHKFSVTGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGLTCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNHNSHYVYIMADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSQLSKDPNEERDHTVLLEFVTAAGITLGMGELYK

Excerpts

No excerpts have been added for Citrine2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change