compare

Comparison List

Citrine2

Citrine2 is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2018, derived from Aequorea victoria. It has moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Dimer Aequorea victoria 26.9 kDa -

FPbase ID: ZWH88

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
509 522 98,000 0.7 68.6 5.9   3.3
Edit States/Attributes

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
5.34 50.0 (mW) Laser Point Scanning Confocal
59.63 Arc-lamp Widefield
A caution on interpretation of photostability measurements
Add photostability info

Citrine2 Sequence

BLAST

Citrine2 was derived from mCitrine with the following mutations: S30T/M69T/Y145H/N149Y/V163A/K206Q/K214E/M218T/D234G
amino acid numbers relative to avGFP. show relative to mCitrine

MVSKGEELFTGVVPILVELDGDVNGHKFSVTGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGLTCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNHNSHYVYIMADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSQLSKDPNEERDHTVLLEFVTAAGITLGMGELYK

Excerpts

Using this system, we developed Citrine2 with double the photostability, and equivalent brightness, compared to the starting template, mCitrine.

Wiens et al. (2018)

Primary Reference

Enhancing fluorescent protein photostability through robot-assisted photobleaching

Wiens Md, Hoffmann F, Chen Y, Campbell Re

(2018). Integrative Biology, , . doi: 10.1039/c8ib00063h. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change