compare

Comparison List

BFP5

BFP5 is a basic (constitutively fluorescent) blue fluorescent protein published in 1996, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 26.9 kDa -

FPbase ID: RSDF7

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
385 450          
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

BFP5 Sequence

BLAST

BFP5 was derived from P4 with the following mutations: F64M/V68I

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTMSHGIQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for BFP5
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Fluorescence resonance energy transfer between blue-emitting and red-shifted excitation derivatives of the green fluorescent protein

Mitra Rd, Silva Cm, Youvan Dc

(1996). Gene, 173(1) , 13-17. doi: 10.1016/0378-1119(95)00768-7. Article

Additional References

  1. Improved Fluorescence and Dual Color Detection with Enhanced Blue and Green Variants of the Green Fluorescent Protein

    Yang T-T, Sinai P, Green G, Kitts Pa, Chen Y-T, Lybarger L, Chervenak R, Patterson Gh, Piston Dw, Kain Sr

    (1998). Journal of Biological Chemistry, 273(14) , 8212-8216. doi: 10.1074/jbc.273.14.8212. Article

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change