compare

Comparison List

Azurite

a.k.a. BFP.B3

Azurite is a basic (constitutively fluorescent) blue fluorescent protein published in 2006, derived from Aequorea victoria. It is reported to be a rapidly-maturing weak dimer with low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Weak dimer Aequorea victoria 26.9 kDa -

FPbase ID: ZMWEJ

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
383 447 26,200 0.55 14.41 5.0 18.0 3.65
Edit States/Attributes

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
33.0   Subach et al. (2008)
A caution on interpretation of photostability measurements
Add photostability info

Azurite Sequence

BLAST

Azurite was derived from BFP with the following mutations: F64L/V150I/V224R

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNIYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFRTAAGITHGMDELYK
GenBank: ABK79091
IPG: 6379415

Excerpts

No excerpts have been added for Azurite
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Blue fluorescent proteins with enhanced brightness and photostability from a structurally targeted library

Mena Ma, Treynor Tp, Mayo Sl, Daugherty Ps

(2006). Nature Biotechnology, 24(12) , 1569-1571. doi: 10.1038/nbt1264. Article   Pubmed

Additional References

  1. Conversion of Red Fluorescent Protein into a Bright Blue Probe

    Subach Om, Gundorov Is, Yoshimura M, Subach Fv, Zhang J, Grüenwald D, Souslova Ea, Chudakov Dm, Verkhusha Vv

    (2008). Chemistry & Biology, 15(10) , 1116-1124. doi: 10.1016/j.chembiol.2008.08.006. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change