compare

Comparison List

Azurite

a.k.a. BFP.B3

Azurite is a basic (constitutively fluorescent) blue fluorescent protein published in 2006, derived from Aequorea victoria. It is reported to be a rapidly-maturing weak dimer with low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Weak dimer Aequorea victoria 26.9 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
383 447 26,200 0.55 14.41 5.0 18.0 3.65

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
33.0 Subach et al. (2008)

Azurite Sequence

Azurite was derived from BFP with the following mutations: F64L/V150I/V224R

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNIYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFRTAAGITHGMDELYK
GenBank: ABK79091
IPG: 6379415

Excerpts

No excerpts have been added for Azurite
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

External Resources

Something missing or incorrect? Submit a change Submit a change