compare

Comparison List

AvicFP3

AvicFP3 is a basic (constitutively fluorescent) green fluorescent protein published in 2019, derived from Aequorea victoria.
+
Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 25.5 kDa -

FPbase ID: ZJWZK

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
post-conversion              
pre-conversion 480 520 0.001        
Edit state transitions

Photostability

No photostability measurements available ... add one!

AvicFP3 Sequence

MNCGALLFKQKIPFIVELDGDVNGQVFSVRGNGFGDGSTGKIEIKFVCTTGEIPVAWESLVCSLAYGALVFTKYPSNINDFFKSTMPKGYIQERKITFENDGQYETRAEVTYENGALYNRVKLNGSGFRKDGNILGKKLDATSLGTCIYIMSNDQGNGLKGVYNKAYKVIGGNRQLASHQQTHTPIGDGLVSIPDYHVMHNHTSCSKDPTEPRDHLILKESVTAVDCQTAYM

Excerpts

AvicFP3 is highly homologous to AvicFP2 (96% amino acid identity), and is similarly green fluorescent when expressed and purified in the dark. Like AvicFP2, AvicFP3 converts to a green-absorbing chromoprotein when exposed to blue light. We suspect that AvicFP3 is so highly sensitive to blue light exposure that the act of taking an absorbance measurement is enough to partially photoconvert the protein.

Lambert et al. (2019)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change