compare

Comparison List

AQ14

AQ14 is a basic (constitutively fluorescent) red fluorescent protein published in 2005, derived from Actinia equina.
+
Oligomerization Organism Molecular Weight Cofactor
? Actinia equina 25.8 kDa -

FPbase ID: WBK4U

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
595 663          

Photostability

No photostability measurements available ... add one!

AQ14 Sequence

AQ14 was derived from aeBlue with the following mutations: K6T/K7E/Y101S/C143S/M146I/S158A

MASLVTEDMCIKMTMEGTVNGHHFKCVGEGEGKPFEGTQVEKIRITEGGPLPFAYDILAPCCMYGSKTFIKHVSGIPDYFKESFPEGFTWERTQIFEDGGSLTIHQDTSLQGNNFIFKVNVIGANFPANGPVMQKKTAGWEPSVEILYPRDGVLCGQALMALKCTDGNHLTSHLRTTYRSRKPSNAVNMPEFHFGDHRIEILKAEQGKFYEQYESAVARYCEAAPSKLGHH

Excerpts

No excerpts have been added for AQ14
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change