compare

Comparison List

aeBlue

a.k.a. aeCP597

aeBlue is a basic (constitutively fluorescent) fluorescent protein published in 2005, derived from Actinia equina. It is reported to be a rapidly-maturing tetramer.
+
Oligomerization Organism Molecular Weight Cofactor
Tetramer Actinia equina 25.9 kDa -

FPbase ID: LFOL4

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
597         24.0  
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

aeBlue Sequence

BLAST
MASLVKKDMCIKMTMEGTVNGHHFKCVGEGEGKPFEGTQVEKIRITEGGPLPFAYDILAPCCMYGSKTFIKHVSGIPDYFKESFPEGFTWERTQIFEDGGYLTIHQDTSLQGNNFIFKVNVIGANFPANGPVMQKKTAGWEPCVEMLYPRDGVLCGQSLMALKCTDGNHLTSHLRTTYRSRKPSNAVNMPEFHFGDHRIEILKAEQGKFYEQYESAVARYCEAAPSKLGHH
GenBank: DQ159069

Excerpts

Interestingly, one CP, aeBlue, changed color over time (Fig. 1c), indicating multi-step maturation.

Liljeruhm et al. (2018)

Primary Reference

Far-red fluorescent proteins evolved from a blue chromoprotein fromActinia equina

Shkrob Ma, Yanushevich Yg, Chudakov Dm, Gurskaya Ng, Labas Ya, Poponov Sy, Mudrik Nn, Lukyanov S, Lukyanov Ka

(2005). Biochemical Journal, 392(3) , 649-654. doi: 10.1042/bj20051314. Article   Pubmed

Additional References

  1. aeBlue Chromoprotein Color is Temperature Dependent

    Tamayo-Nuñez J, De La Mora J, Padilla-Vaca F, Vargas-Maya Ni, Rangel-Serrano , Anaya-Velázquez F, Páramo-Pérez I, Reyes-Martínez Je, España-Sánchez Bl, Franco B

    (2019). Protein & Peptide Letters, 27(1) , 74-84. doi: 10.2174/0929866526666190806145740. Article   Pubmed

  2. Engineering a palette of eukaryotic chromoproteins for bacterial synthetic biology

    Liljeruhm J, Funk Sk, Tietscher S, Edlund Ad, Jamal S, Wistrand-Yuen P, Dyrhage K, Gynnå A, Ivermark K, Lövgren J, Törnblom V, Virtanen A, Lundin Er, Wistrand-Yuen E, Forster Ac

    (2018). Journal of Biological Engineering, 12(1) , . doi: 10.1186/s13036-018-0100-0. Article

  3. In vitro characterization of genetically expressed absorbing proteins using photoacoustic spectroscopy

    Laufer J, Jathoul A, Pule M, Beard P

    (2013). Biomedical Optics Express, 4(11) , 2477. doi: 10.1364/boe.4.002477. Article

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change